Ontology highlight
ABSTRACT:
SUBMITTER: Zheng J
PROVIDER: S-EPMC10930891 | biostudies-literature | 2024 Feb
REPOSITORIES: biostudies-literature

Zheng Jiawei J Li Nan N Li Xue X Han Yaqi Y Lv Xinru X Zhang Huimin H Ren Linzhu L
International journal of molecular sciences 20240220 5
Porcine circovirus 4 (PCV4) is a newly identified virus belonging to PCV of the <i>Circoviridae</i> family, the <i>Circovirus</i> genus. We previously found that PCV4 is pathogenic in vitro, while the virus's replication in cells is still unknown. In this study, we evaluated the N-terminal of the PCV4 capsid (Cap) and identified an NLS at amino acid residues 4-37 of the N-terminus of the PCV4 Cap, <sup>4</sup>RSRYSRRRRNRRNQRRRGLWPRASRRRYRWRRKN<sup>37</sup>. The NLS was further divided into two f ...[more]