Ontology highlight
ABSTRACT:
SUBMITTER: Lu X
PROVIDER: S-EPMC2866266 | biostudies-literature | 2010 Mar
REPOSITORIES: biostudies-literature

Lu Xiangyun X Che Qiaolin Q Lv Yi Y Wang Meijuan M Lu Zekuan Z Feng Feifei F Liu Jingze J Yu Haining H
Protein science : a publication of the Protein Society 20100301 3
A novel defensin-like antimicrobial peptide named longicornsin was isolated from the salivary glands of the hard tick, Haemaphysalis longicornis, using a 10-kDa cut-off Centriprep filter and reversed-phase high-performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined as DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG by Edman degradation. The cDNA encoding longicornsin was cloned by cDNA library screening. The predicted protein from the cDNA sequence was composed of 78 ...[more]