Unknown

Dataset Information

0

Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.


ABSTRACT: In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional 1H-1H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented.

SUBMITTER: Dai H 

PROVIDER: S-EPMC4356134 | biostudies-literature | 2008 Jul

REPOSITORIES: biostudies-literature

altmetric image

Publications

Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.

Dai Huaien H   Rayaprolu Subrahmanyam S   Gong Yuxi Y   Huang Rudan R   Prakash Om O   Jiang Haobo H  

Journal of peptide science : an official publication of the European Peptide Society 20080701 7


In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentra  ...[more]

Similar Datasets

| S-EPMC5596513 | biostudies-literature
| S-EPMC3210862 | biostudies-literature
| S-EPMC2020821 | biostudies-literature
| PRJNA414142 | ENA
| PRJNA81039 | ENA
| PRJNA71235 | ENA
| PRJNA320092 | ENA
| PRJNA79369 | ENA
| PRJNA81037 | ENA
| PRJNA975534 | ENA