Ontology highlight
ABSTRACT:
SUBMITTER: Fan L
PROVIDER: S-EPMC9266618 | biostudies-literature | 2022 Jun
REPOSITORIES: biostudies-literature

Fan Lu L Warnecke Athanasia A Weder Julia J Preller Matthias M Zeilinger Carsten C
International journal of molecular sciences 20220628 13
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC<sub>50</sub> of 50 μM. The binding motif can influence the activity of Hsp9 ...[more]