Project description:Primary objectives: The primary objective is to investigate circulating tumor DNA (ctDNA) via deep sequencing for mutation detection and by whole genome sequencing for copy number analyses before start (baseline) with regorafenib and at defined time points during administration of regorafenib for treatment efficacy in colorectal cancer patients in terms of overall survival (OS).
Primary endpoints: circulating tumor DNA (ctDNA) via deep sequencing for mutation detection and by whole genome sequencing for copy number analyses before start (baseline) with regorafenib and at defined time points during administration of regorafenib for treatment efficacy in colorectal cancer patients in terms of overall survival (OS).
Project description:Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.
Project description:The tarantula genus Sericopelma was originally defined based on male specimens, most notably lacking tibial spurs on leg I. Early female specimens were unrecognised as Sericopelma, and typically placed in Eurypelma - a dumping ground for problem specimens. The first females were only later recognised, but authors failed to adequately define female Sericopelma. Here, the holotypes of the southern-most alleged Brachypelma species, Brachypelma embrithes (Chamberlin & Ivie, 1936) and Brachypelma angustum Valerio, 1980 were examined, and finding both to possess defining characteristics of Sericopelma were transferred. The taxonomic attributes to define Sericopelma relative to Brachypelma and select other Neotropical genera are discussed, especially for females. As important diagnostic characters for Sericopelma, the single (unilobar) spermathecae swollen at the apex forming a P-shaped cross-section, metatarsus IV with trace scopula, femur IV with a dense retrolateral pad of plumose hair, plus other attributes. Some past confusion in these characters are clarified and Sericopelma relative to Brachypelma and Megaphobema mesomelas are discussed. Finally recommendations are given about these taxonomic changes for CITES regulations.